PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G428700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 475aa    MW: 53440.7 Da    PI: 5.7805
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G428700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.8e-17129175148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT++Ed llv++vk+ G + W+ Ia++m  gR +kqc++rw+++l
  Aqcoe1G428700.1.p 129 KGQWTEQEDRLLVKLVKENGVKKWSQIAHKMV-GRAGKQCRERWHNHL 175
                        799*****************************.*************97 PP

2Myb_DNA-binding54.13.5e-17181223145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +++W++eE+  l++a++++G++ W+ Ia+ ++ gR+++ +k++w+
  Aqcoe1G428700.1.p 181 KDSWSEEEEIMLIEAHEKFGNR-WAEIAKQIP-GRSENAIKNHWN 223
                        679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.366124179IPR017930Myb domain
SuperFamilySSF466896.11E-30127222IPR009057Homeodomain-like
SMARTSM007172.7E-16128177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-25130183IPR009057Homeodomain-like
CDDcd001673.15E-15132175No hitNo description
PfamPF139217.8E-19132192No hitNo description
SMARTSM007171.9E-17180228IPR001005SANT/Myb domain
PROSITE profilePS5129421.291180230IPR017930Myb domain
CDDcd001674.94E-14183226No hitNo description
Gene3DG3DSA:1.10.10.602.9E-21184228IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MEGVGSFVFD FQNHLARPTP PLSAIEKFLL SSNDHTQKQI HTSVKNNDRI VSSNGLGEFS  60
TSSGLIDDYA GRFSFVSLPD TSFDGGQPFG WTKEMKNIVG LKSEVKLKEK STLSMEKKTK  120
NGSSTTLIKG QWTEQEDRLL VKLVKENGVK KWSQIAHKMV GRAGKQCRER WHNHLRPDIK  180
KDSWSEEEEI MLIEAHEKFG NRWAEIAKQI PGRSENAIKN HWNATKRRQT AGKMNKGACR  240
GSKTQPSILQ EYIRSKYMMD YSPPFTPTIT SPAIVSTPST NPSSQVSFTH SEPSESSYTD  300
DSTLISHMYN DDELLFMGGL LENIYEEPYL ESIVVDSKDG EGAFYYGHPQ NSLVFGSSEQ  360
DAYNGYSPSL EVMSNCNYLA ATSTNLNEVL LQENMAKEAD TKASQMYSDL YLSYLFDRMA  420
PSCEAGANYC ENISSHDLPI DQPAAYNKKK EMDLIEMIST SQFSHQYIGE NTYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-441272292104C-Myb DNA-Binding Domain
1msf_C3e-441272292104C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262919.11e-117PREDICTED: transcription factor MYB29
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.13e-53myb domain protein 64